Protein Info for PP_3244 in Pseudomonas putida KT2440

Annotation: Magnesium transporter, MgtC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 100 to 128 (29 residues), see Phobius details PF02308: MgtC" amino acids 12 to 133 (122 residues), 126.3 bits, see alignment E=8.5e-41 PF21770: MgtC_SapB_C" amino acids 150 to 227 (78 residues), 91.6 bits, see alignment E=3.6e-30

Best Hits

Swiss-Prot: 46% identical to MGTC_SALTI: Protein MgtC (mgtC) from Salmonella typhi

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to ppf:Pput_2517)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HV9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PP_3244 Magnesium transporter, MgtC family (Pseudomonas putida KT2440)
MDWKVFLLRVSIALVLGALIGAERQLRQRLTGLRTNALVSTGACLFVLMTQAVPGMAPAD
ASRVAAYVVSGIGFLGGGVIMRDGFNVRGLNTAATLWCTAAVGVLCSLGLMMEAALGSLV
VLCANILLRDIAQRLDRQDVVPASEVEQHFEVRIVCRGEDEIQVRSLMLHSLGDPQLRLQ
SLQSQDLDNPARLEVRAELLGTAQAPAQLERLVSRVSLEKGVSSVRWQLQPQVLATD