Protein Info for PP_3242 in Pseudomonas putida KT2440

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details PF02743: dCache_1" amino acids 56 to 244 (189 residues), 51.8 bits, see alignment E=7.8e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 344 to 512 (169 residues), 157.5 bits, see alignment E=1.3e-50 PF00990: GGDEF" amino acids 348 to 508 (161 residues), 155 bits, see alignment E=1.5e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3242)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HW1 at UniProt or InterPro

Protein Sequence (522 amino acids)

>PP_3242 GGDEF domain protein (Pseudomonas putida KT2440)
MCAARKQDDDGLFAISGEGRAVALFRLVLAFMLVVMLAFVLVEGWRIWRDYRFAYNNAEN
MVSNLARATAQHAEDAIRQVDAITGALAERLEGDGFDHIDRPRLHALLAQQKRIMPQLHG
LFVYGPDGSWIVTDQAAIPPKANNADRDYFAYHRSHNDPGVHIGSVVRSRSTGDLIIPIS
RRLEHADGSFAGVLLGTIKVAWFVRYYGDFKIDERGALVLAKRDGTLLVRRPFVEQVIGR
SLANSEIFRNHLPYATEGVAEAVAVVDGTPRLYGYRALSSYPLVVEAGLSRESIVAPWRY
DAIKSVAVLLLLLVGLAAFGGVVLRQLRERIVIERALLQAHQTLKALALTDSLTGLGNRR
RLDGVFEPELRRARRQGYPLALVMLDLDYFKAYNDHYGHPAGDQCLRRFAEVLQQALKRP
ADLAVRYGGEEFTLLLPDTDGRGAELLVQELQQLLRRQALEHAASPLGRVSFSAGIAVVD
LAREGGTIEALVAAADGALYQAKQQGRDGYCVAGSLAAGQNC