Protein Info for PP_3233 in Pseudomonas putida KT2440

Annotation: transcriptional regulator with 4Fe-4S cluster, Crp/Fnr family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00027: cNMP_binding" amino acids 45 to 127 (83 residues), 54.1 bits, see alignment E=1.9e-18 PF13545: HTH_Crp_2" amino acids 162 to 235 (74 residues), 57.4 bits, see alignment E=1.8e-19 PF00325: Crp" amino acids 187 to 217 (31 residues), 44.9 bits, see alignment 1.2e-15

Best Hits

Swiss-Prot: 43% identical to FNR_HAEIN: Anaerobic regulatory protein (fnr) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3233)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HX0 at UniProt or InterPro

Protein Sequence (243 amino acids)

>PP_3233 transcriptional regulator with 4Fe-4S cluster, Crp/Fnr family (Pseudomonas putida KT2440)
MSGSAEMGARPHVKCLACSLSRLCLPASLSADEVDKLERIVRRNRPLKRGEYLFKANEPM
EHVFALRSGAIKNFLLDAEGTERVTGFLLPGEMLGLDAIGASHYRSFAVALELSLVCSIR
LDQLVDLSGQIPGLRYQLLHMLSLGIQGKDEHLRCCHGRAEQRLAIFLLGMSARYQARGL
RADVFNLPMSRGDIANYLDLTLETVSRLFSRFVHAGLVLCAGREVRLIDMQGLVNLTRLE
EPT