Protein Info for PP_3229 in Pseudomonas putida KT2440

Annotation: putative Periplasmic aliphatic sulfonate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 29 to 308 (280 residues), 209.6 bits, see alignment E=3e-66 PF13379: NMT1_2" amino acids 29 to 252 (224 residues), 42.3 bits, see alignment E=2e-14 PF04069: OpuAC" amino acids 49 to 230 (182 residues), 37.4 bits, see alignment E=5.6e-13 PF09084: NMT1" amino acids 54 to 250 (197 residues), 64.4 bits, see alignment E=3.6e-21 PF12974: Phosphonate-bd" amino acids 71 to 194 (124 residues), 31 bits, see alignment E=4.5e-11 PF00497: SBP_bac_3" amino acids 112 to 238 (127 residues), 28 bits, see alignment E=4e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3229)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HX4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_3229 putative Periplasmic aliphatic sulfonate-binding protein (Pseudomonas putida KT2440)
MTFKPLRQLGLALLASALLPSLASAEQTLRIGYQKSSTLLTLLKARGTLEQRLQAEGIRV
TWHEFPSGLPLLEALNLGNVDLSADVADTVPVFTQAAGAKLTYFAREAPSPTAQAILVPA
DSPLKTLADLKGKRVAVTKAAGSHYLLIQALAKAGLTFKDITPAYLIPADGRAAFENHKV
DAWVTWDPYVASAQRQQNARILVDGSELASYQRYYLAGSDYAKAHPEVLQQVYLALREAG
AWTKANPEAAARILGPLWGNLDSATVQQANARRSYDVQPVKLDNLAEQQRIADAFYREGL
LPKAVDTSAVDVYQPPSN