Protein Info for PP_3203 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 348 (334 residues), 122.3 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3203)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HZ9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PP_3203 Major facilitator family transporter (Pseudomonas putida KT2440)
MVAERTAGSAQAALLLFGSCLPVLGAVLIAPVLPRMHAYFAETPGVAVLVPVALTLPALV
IALLAPLAGVLADRVGRRALLLASMLLYSLCGLLPLWLDSLVLIVASRAGIGLAEAGIMT
CCTTLMGDYFDGQRRARLFALQMVVTSLAAALFMGVGGALGESDWRTPFTLYAVGALCLP
LMALLLWEPRACQAASEASVDSRFPWAALTPLYLLTVLAGVSLFIVPVQAGYVLQLLHID
APRQVGLAMGANQLGVLAGALAFRLLARLPAGRLLAMGFATAGLGGGLMALASSHAPVVL
AVLINGLGVGLLLPTLITLVMQQVGFDQRGRATGGFTSAIFAGEFVSPLIVLALTAGVAT
HLPHALLLVAIGQLLLAPVCLSLMRHRRAVTVAGAR