Protein Info for PP_3175 in Pseudomonas putida KT2440

Annotation: putative Dioxygenase, ferredoxin reductase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 119 to 137 (19 residues), see Phobius details PF00355: Rieske" amino acids 3 to 88 (86 residues), 60.2 bits, see alignment E=6.1e-20 PF07992: Pyr_redox_2" amino acids 119 to 411 (293 residues), 187.4 bits, see alignment E=1.6e-58 PF13738: Pyr_redox_3" amino acids 208 to 375 (168 residues), 31 bits, see alignment E=6.7e-11 PF00070: Pyr_redox" amino acids 260 to 338 (79 residues), 66.5 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3175)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I27 at UniProt or InterPro

Protein Sequence (506 amino acids)

>PP_3175 putative Dioxygenase, ferredoxin reductase component (Pseudomonas putida KT2440)
MTQYAVARLAQLDEHRPLRVQAGSEELILVRQGEQVHAYQGNCPHAGAPLDEGVVCGGLL
VCPWHKATFAVDDGVVCEPPALADLRRYKAWIKGDEVWVDDQPLPATEPPRHSDARCFVV
VGAGAAGSAAVATLLAHGFAGRLVWIDQERQPAYDRTALSKFVIAGQMPPDEVPALLEAD
ALRKGQLERKYGKVRTLNSQKRQVTLADGQQIDYDACLLATGGKALRPDIPGADLPGVFT
LRSLEDAARLLDAAEPGQPVVIVGDGFIGLEAASALRKYGVQVHVVSRHEVPLARQLGER
IGRCIRALHERKGITFHGPTEVERIEGLDKVEAVQLTNGERLQTPLVLLGTGVRPATAFL
QGVPLGEDKSVRVDAEMRAADGLWAAGDIATFPLTGRPVRIEHWRLAQQHGVIAAANMLG
EQRRYADVPFFWTYQHGRTYEVLGHARDWNRIEFVGEPEKGDFVALQCVDERVEAVIAKG
YSDAMATLSQRLKRPLSLQEAWALIG