Protein Info for PP_3172 in Pseudomonas putida KT2440

Annotation: Group II intron-encoding maturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR04416: group II intron reverse transcriptase/maturase" amino acids 63 to 406 (344 residues), 419.6 bits, see alignment E=5.3e-130 PF00078: RVT_1" amino acids 119 to 324 (206 residues), 149.8 bits, see alignment E=9.4e-48 PF08388: GIIM" amino acids 342 to 418 (77 residues), 76.5 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3820)

Predicted SEED Role

"Retron-type RNA-directed DNA polymerase (EC 2.7.7.49)" (EC 2.7.7.49)

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.49

Use Curated BLAST to search for 2.7.7.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>PP_3172 Group II intron-encoding maturase (Pseudomonas putida KT2440)
MPPVGVAVSLVTVMQKFPTAETVIPNPGQKPRVMPDSAKVPAASATWTNAEPDTLMERVL
APANLRRAYQRVVSNKGAPGADGMTVADLAGYVKQYWPTLKARLLAGEYHPQAVRAVEIP
KPQGGTRQLGIPSVVDRLIQQALQQQLTPIFDPLFSDYSYGFRPGRSTHQAIEMARAHVT
AGHRWCVELDLEKFFDRVNHDILMACIERRIKDKCVLRLIRRYLEAGIMSGGVVSPRQEG
TPQGGPLSPLLSNILLDELDRELERRGHRFVRYADDANIYVRSPRAGERVLVSVERFLRE
RLKLTVNRKKSQVARAWKCDYLGYGMSWHQQPRLRVARMSLDRLRDRLRMLLRSVRARKM
ATVIERINPVLRGWASYFKLSQSKRPLEELDGWVRHKLRCVIWRQWKQPPTRLRNLMRLG
LSEERANKSAFNGRGPWWNSGAQHMNYALPKKLWDRLGLVSILDTINRLSRVT