Protein Info for PP_3165 in Pseudomonas putida KT2440

Annotation: benzoate MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 384 to 402 (19 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 382 (355 residues), 151.4 bits, see alignment E=4.8e-48 amino acids 299 to 427 (129 residues), 35.7 bits, see alignment E=7.3e-13 PF00083: Sugar_tr" amino acids 34 to 381 (348 residues), 113.5 bits, see alignment E=1.8e-36 PF06779: MFS_4" amino acids 38 to 191 (154 residues), 39.4 bits, see alignment E=7.7e-14

Best Hits

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 100% identity to ppu:PP_3165)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I36 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PP_3165 benzoate MFS transporter (Pseudomonas putida KT2440)
MRTLDVHPIIDNARFTPFHWMVMAWCGLLLIFDGYDLFIYGVVLPVIMKEWGLTPLQAGA
LGSYALFGMMFGALAFGSLADRIGRKKGIAICFALFSGATILNGFASNPSEFGIYRFIAG
LGCGGLMPNAVALMNEYAPKRLRSTLVAIMFSGYSLGGMLSAGVGIFMLPRFGWESMFFA
AAVPLLLLPVILYYLPESIGFLVRQGRIEEARTLLKRLDPDCDVQADDVLQAADRKGSGA
SVLELFRNGLAIRTLALWVAFFCCLLMVYALSSWLPKLMANAGYSLGSSLSFLLALNFGG
MAGAILGGWLGDRYNLVKVKVAFFIAAALSISLLGVNSPMPVLYLLIFIAGATTIGTQIL
LYAGAAQMYGLSVRSTGLGWASGIGRNGAIVGPLLGGALMGINLPLQLNFIAFAIPGAIA
ALAMAVHLASGRRHAQTLAAQA