Protein Info for PP_3142 in Pseudomonas putida KT2440

Annotation: putative Sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 35 to 473 (439 residues), 461.3 bits, see alignment E=4.7e-142 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 36 to 473 (438 residues), 462.3 bits, see alignment E=2.2e-142 PF13727: CoA_binding_3" amino acids 66 to 247 (182 residues), 82.7 bits, see alignment E=3.5e-27 PF02397: Bac_transf" amino acids 283 to 466 (184 residues), 222.3 bits, see alignment E=3.4e-70

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to ppu:PP_3142)

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I59 at UniProt or InterPro

Protein Sequence (473 amino acids)

>PP_3142 putative Sugar transferase (Pseudomonas putida KT2440)
MVFEPRSSRSLLQRRSSVSNAIQAGLDGIAVTGIAWYLIYDQFGYITSDYVIMLLLLIGA
LAVIYDHYAIYRTNVGLSIKAFRLFKAWSATFCFLVVMAFLTKQSETYSRLLMGQLFVIG
YFAQLFLHFAVRELQKRFTAHARLDNALIIGNGDLANFLYQKISNNPWFGERVLGCVVLD
KGDEQGPESAEGKQRLPVLGHIGDLDELVARHGIRTVYLVTPLGGSEVINDVYFKLLDKC
IAVNWVPDIFSLRLINHSVREIAGIPVLTLSETPLTGMSLFLKNLEDRVLAALILLFASP
VLLAVALAIKIDSRGPVFFRQERTGWTGESFRIWKFRSMHVHQPEAGVVKQAQKNDPRLT
RVGAFIRRTSLDELPQLFNVLTGEMSLVGPRPHALQHDTLYSQDIVDYFARHNIKPGMTG
LAQVRGFRGETKDIEQMIQRVDSDIEYINNWSLWLDFVILVRTLNAFTGKQAY