Protein Info for PP_3128 in Pseudomonas putida KT2440

Annotation: putative Exopolysaccharide biosynthesis/transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF01656: CbiA" amino acids 90 to 263 (174 residues), 26.8 bits, see alignment E=4.5e-10 PF13614: AAA_31" amino acids 99 to 236 (138 residues), 30.5 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: K08253, non-specific protein-tyrosine kinase [EC: 2.7.10.2] (inferred from 100% identity to ppf:Pput_2587)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I73 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_3128 putative Exopolysaccharide biosynthesis/transport protein (Pseudomonas putida KT2440)
MDRIKPAVGNNIHQVTPGTPQALSPAPGTALAEVPGQFDYVNTKVVPLRADHLERNRIVA
YNKNSNMNGPIDLLRTQVLRAMDENGWRTLAITSPTPEAGKTMLAINLAMSIAHHTTKTA
LLVDFDLRRPKVGSYLGLPMEQALNEFLTDKAELQDCLVNPTLPRFVVLPTRVPVPLSTE
MLSSPKVNNLIGDLRNRYESRICIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNNKKEI
EDCLHHLGTVNLIGTVLNKADEQPRTYY