Protein Info for PP_3124 in Pseudomonas putida KT2440

Annotation: putative short chain fatty acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 401 to 402 (2 residues), see Phobius details amino acids 408 to 408 (1 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 440 to 464 (25 residues), see Phobius details PF02667: SCFA_trans" amino acids 12 to 456 (445 residues), 284 bits, see alignment E=1.2e-88

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 100% identity to ppf:Pput_2592)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I77 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PP_3124 putative short chain fatty acid transporter (Pseudomonas putida KT2440)
MAAEIQDSRSARFALRCSNWAERWFPDSWVFAALAVLLVCIGALAMGAKPTDTAKAFGDG
FWSLIPFTMQMAFVVIGGYVVASSPPAARLIDRLARIPGNGRSAVCWVALISMLASLLNW
GLSLVFGGLLVRALARRTDLKMDYRAAGAAAYLGLGAVWALGLSSSAAQLQANPASLPPS
ILSITGVIPFTETIFLWQSGVMLAALVVVSLVIAYATAPGPNSARSAEDCGVDPSFTAPP
APQRTRPGEWLEHSPILILLLVALAAGWLYQEFATKPAITAISGLNTYNLLFIMLGALLH
WRPRSFLDAVARAVPTTTGVLIQFPLYGSIAAILTQVKGVDEQTLAHHISLFFTQIATHD
TYAVLMGVYSAVLGFFIPSGGGKWIIEAPYVMLVANDLQYHLGWAVQIYNAAEALPNLIN
PFYMLPLLGVLGLKARDLIGFSFVQLLVHVPLVLVLLWALGTTLQYVPPVMP