Protein Info for PP_3123 in Pseudomonas putida KT2440

Annotation: acetoacetyl CoA-transferase (subunit B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details TIGR02428: 3-oxoacid CoA-transferase, B subunit" amino acids 4 to 208 (205 residues), 332.7 bits, see alignment E=3.3e-104 PF01144: CoA_trans" amino acids 6 to 201 (196 residues), 161.6 bits, see alignment E=1.9e-51 PF13336: AcetylCoA_hyd_C" amino acids 100 to 200 (101 residues), 26.7 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 62% identical to SCOB_XANCB: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B (lpsJ) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01029, 3-oxoacid CoA-transferase subunit B [EC: 2.8.3.5] (inferred from 98% identity to pen:PSEEN2465)

MetaCyc: 57% identical to succinyl-CoA-transferase subunit B (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I78 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PP_3123 acetoacetyl CoA-transferase (subunit B) (Pseudomonas putida KT2440)
MALTREQMAQRVARELKDGYYVNLGIGIPTLVANYVPADMDVMLQSENGLLGMGEFPTES
TLDADMINAGKQTVTARRGASIFDSAQSFAMIRGGHVDLTVLGAFEVDVQGNIASWMIPG
KLVKGMGGAMDLVAGADNIIVTMTHASKDGESKLLPKCSLPLTGAGCIRKVLTDLAYLEI
EDGAFILRETAPGVSVEEIIEKTAGKLIVPDDVKEMTF