Protein Info for PP_3086 in Pseudomonas putida KT2440

Annotation: putative RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 160 (146 residues), 58.7 bits, see alignment E=2.8e-20 PF04542: Sigma70_r2" amino acids 15 to 81 (67 residues), 39.3 bits, see alignment E=9.2e-14 PF07638: Sigma70_ECF" amino acids 37 to 160 (124 residues), 23 bits, see alignment E=1.3e-08 PF08281: Sigma70_r4_2" amino acids 113 to 161 (49 residues), 49.5 bits, see alignment E=5.3e-17 PF04545: Sigma70_r4" amino acids 118 to 162 (45 residues), 32.7 bits, see alignment E=8.6e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ppu:PP_3086)

Predicted SEED Role

"RNA polymerase sigma-70 factor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IB3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PP_3086 putative RNA polymerase sigma-70 factor (Pseudomonas putida KT2440)
MPPAEPSLNLQVQTLYTEHHGWLQGWLGRKLGNACDAADLAHDTFVRLLSRQGNPYFGNE
PRALLTHIAKGLVVDRWRRQDVERAYLEAIAHLPQPEVPSPETRWLILETLYRIDAMLRD
MPARVRQVFLLSQLDGLTYAQIAEQLQVSLITIKRDMRTAFLACLSIE