Protein Info for PP_3082 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 342 (307 residues), 77.6 bits, see alignment E=4.6e-26 amino acids 229 to 412 (184 residues), 52.8 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3082)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IB7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PP_3082 putative Membrane protein (Pseudomonas putida KT2440)
MPGRAGVRAEKVLIPLIQLEVRMSPRLLAMALAPLLGLFIIALGNGFMSSLTTLRLGAAG
ESATTIGIVSSTYFIGLTLGAIFNDRLILRIGHIRAYTSFASLIAVTILLQGLFYEVTWW
SVLRLINGWAAVGVFLVIESWLLLAGDAKIRGRLLALYMIAFYGAGVIAQAGLGEITQLG
DTAPFMLAGVLAALSVLPIVILPRVSPLLDQVEPLKPRQLLGVAPSGLVGCFGSGVAIAG
IYALLPLYLQRIGLEVGEVGNMMAWVILGAMLLQYPVGRWSDRKDRLDVLLALAALCVVL
SLVTVFLPSDSFLLPAMLFLLGGGVFTLYPVAVSHAADRAPSDALVPMIQGLLLINSLGS
AMAPVAISPMMTEFGEAGLFWAFAVVNLAMVCFFMWRRGKRPAAEHPAPFTASTTFSPTG
AELRVTEDLMHAAQEHPPLEPVETPATAQRSESC