Protein Info for PP_3074 in Pseudomonas putida KT2440

Annotation: D-beta-hydroxybutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 99 to 127 (29 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 319 to 345 (27 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3074)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IC5 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_3074 D-beta-hydroxybutyrate permease (Pseudomonas putida KT2440)
MTVLIALAALALLMLAAYRGYSVILFAPIAALGAVLLTDPAAVAPAFTGVFMEKMVGFIK
LYFPVFLLGAVFGKLIELSGFSRSIVAAAIRLLGTRQAMLVIVLVCALLTYGGVSLFVVV
FAVYPFAAEMFRQSNIPKRLIPATIALGAFSFTMDALPGTPQIQNIIPSTFFNTTAWAAP
WLGLIGTLFVFFTGMAYLQRQRNKAQRAGEGYGTDLRNEPETAADLSLPNPWLALSPLIL
VGVMNLVFTHWIPHWYGPSHSLQLPGMSAPVQSDVTKLTAIWAVQAALLVGILMVLVCAF
GAIRTRLAEGTKSAVGGALLAAMNTASEYGFGAVIASLPGFLVLADALRSIPNPLVNEAI
TVTLLAGITGSASGGMSIALAAMGDTFIAAAHAADIPLEVLHRVAAMASGGMDTLPHNGA
VITLLAVTGLTHREAYKDIFGITLIKTLAVFVVIATFYATGIV