Protein Info for PP_3003 in Pseudomonas putida KT2440

Annotation: 3-dehydroquinate dehydratase 3, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01220: DHquinase_II
  • amino acids 5 to 141 (137 residues), 186.9 bits, E=7.3e-60
• TIGR01088: 3-dehydroquinate dehydratase, type II
  • amino acids 5 to 144 (140 residues), 184.1 bits, E=5e-59

Best Hits

Swiss-Prot: 75% identical to AROQ_LEPCP: 3-dehydroquinate dehydratase (aroQ) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 99% identity to ppf:Pput_2690)

MetaCyc: 40% identical to 5-deoxy-5-amino-3-dehydroquinate dehydratase (Amycolatopsis mediterranei)
4.2.1.M25 [EC: 4.2.1.M25]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation I (2/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• quinate degradation II (1/3 steps found)
• 3-amino-5-hydroxybenzoate biosynthesis (2/7 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of rifamycin B biosynthesis (4/25 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10 or 4.2.1.M25

Sequence Analysis Tools

See Q88IJ6 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PP_3003 3-dehydroquinate dehydratase 3, type II (Pseudomonas putida KT2440)
MVANVLMLHGINHNMFGKRDPRQYGTATLADIDQALQALGEELGAQVESFQSNFEGAMCE
RIHQAYEDRVDAVLINAGAWTHYSYGIRDALAIIEVPVVEVHMSNIHAREPFRHHSVFAE
VVRGQICGFGVETYLLALRAAMSMV