Protein Info for PP_3002 in Pseudomonas putida KT2440

Annotation: shikimate dehydrogenase-related enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00507: shikimate dehydrogenase" amino acids 5 to 268 (264 residues), 250.5 bits, see alignment E=8.2e-79 PF08501: Shikimate_dh_N" amino acids 7 to 88 (82 residues), 71.2 bits, see alignment E=1.1e-23 PF01488: Shikimate_DH" amino acids 116 to 192 (77 residues), 36 bits, see alignment E=1.1e-12 PF18317: SDH_C" amino acids 238 to 267 (30 residues), 39.5 bits, see alignment (E = 5.4e-14)

Best Hits

Swiss-Prot: 54% identical to AROE_NITEU: Shikimate dehydrogenase (NADP(+)) (aroE) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 99% identity to ppf:Pput_2691)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IJ7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PP_3002 shikimate dehydrogenase-related enzyme (Pseudomonas putida KT2440)
MSDRYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSEGGKGMN
ITAPFKLRAFELADRRSERAQLARAANALKFEDGRIVAENFDGIGLLRDIEENLGEPLRN
RRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNELDHSRLRISRYEALEGQ
SFDIVVNATSASLTADLPPLPADVLGEAALAYELAYGKGLTPFLRLAREQGQARLADGVG
MLVEQAAEAFAWWRGVRPDTRAVINQLTIPLE