Protein Info for PP_2986 in Pseudomonas putida KT2440

Annotation: putative Oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF01370: Epimerase" amino acids 13 to 239 (227 residues), 91.3 bits, see alignment E=3.1e-29 PF16363: GDP_Man_Dehyd" amino acids 13 to 179 (167 residues), 36.5 bits, see alignment E=1.8e-12 PF07993: NAD_binding_4" amino acids 13 to 163 (151 residues), 37.8 bits, see alignment E=5.8e-13 PF05368: NmrA" amino acids 13 to 125 (113 residues), 48.4 bits, see alignment E=4.6e-16 PF04321: RmlD_sub_bind" amino acids 13 to 141 (129 residues), 30.8 bits, see alignment E=7.2e-11 PF01073: 3Beta_HSD" amino acids 13 to 232 (220 residues), 73.8 bits, see alignment E=5.7e-24 PF13460: NAD_binding_10" amino acids 15 to 156 (142 residues), 72 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2986)

Predicted SEED Role

"Dihydroflavonol-4-reductase (EC 1.1.1.219)" in subsystem Biflavanoid biosynthesis or Tannin biosynthesis (EC 1.1.1.219)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IL3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>PP_2986 putative Oxidoreductase (Pseudomonas putida KT2440)
MREQLDQVGSGGVTGATGLLGNNLVRELVARGYTVKGLVRSKAKGEQQFNNLPGVELVVG
DMAEVDAFAASLQGCDTVFHTASFFRDNYKGGSHWKELEQINVSGTRRLLEQAYGAGIRR
FIHTSSIAVLNGAPGTSIEENCLRADADADDYYRSKILADRVVLSFLESHPQMHACMVLP
GWMWGPGDVGPTSSGQLVNDVVQGKLPGLIPGSFSIVDARDVALAHIAAARHGRRGERYL
AAGRHMTMRELMPVLGRMAGVKTPARQIPLPFLYTLAAVQEIYARLTGRPILLSMATLRL
LVREQDRTRFDHRKSEQELGLSFRALELTIADTVAWYRDHGWFEKGSRL