Protein Info for PP_2974 in Pseudomonas putida KT2440

Annotation: putative sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 69 to 69 (1 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details PF00884: Sulfatase" amino acids 310 to 541 (232 residues), 158.5 bits, see alignment E=1.2e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2974)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IM5 at UniProt or InterPro

Protein Sequence (550 amino acids)

>PP_2974 putative sulfatase (Pseudomonas putida KT2440)
MPPRIPASADASNAKEKLGLSEHLASLFGSAALLVALLTLLRVALLLFNRELIGATAWTS
LAEAFFNGLRFDLRLVVYICAPLTLALAYRPAMVCRTWQRIWLGTCAAVAILLGMIELNF
YREFHQRLNALVFQYLQEDPATVLSMLWYGFPVLRLLGAWLALSALFFVLLGWLDIRTRG
KGRSTVESRRTMNKLGHGMALLLCLAISVVVARGTLRQGPPLRWGDAFTTDSMFANHLGL
NGTLSLYAAAKNHYSGDRADKVWKSRMPADQATTLTRDLLFTEHDRLADQNTAAIRRDFQ
PPQDRRLPIRNVVVILMESFAGHFVGALGSEAGITPNFDRLAQEGVLFRRFFANGTHTHQ
GMFASMACFPNLPGFEYLMQTPEGGHQFSGLAQLLSTRDFDDLYVYNGDFAWDNQRGFFS
NQGMTRFIGRNDFVDPVVSDPTWGVADQDMFDRAAEELFKQDPKKPFYALLQTLSNHTPY
ALPGVLPVEPVTGQGSLDQHLTAMRYSDWALGRFFEKARKAPYFKDTLFVVVGDHGFGAQ
EQLTEMDLYR