Protein Info for PP_2973 in Pseudomonas putida KT2440
Annotation: diacylglycerol kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to KDGL_PSEAE: Diacylglycerol kinase (dgkA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 100% identity to ppu:PP_2973)MetaCyc: 54% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]
Predicted SEED Role
"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)
MetaCyc Pathways
- diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
- phosphatidate metabolism, as a signaling molecule (1/5 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.107
Use Curated BLAST to search for 2.7.1.107
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88IM6 at UniProt or InterPro
Protein Sequence (117 amino acids)
>PP_2973 diacylglycerol kinase (Pseudomonas putida KT2440) MKGRSGFTRIIYATRYSLAGLRAAFQGEAAFRQLLLLNAVLLPLACLVDATPSERVLLIL VPMLALIVELLNSAIESTVDRISLSIHPLSKQAKDMGSAAQLIALILIALTWGLILL