Protein Info for PP_2953 in Pseudomonas putida KT2440

Annotation: Alcohol dehydrogenase, zinc-containing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 335 (334 residues), 580.6 bits, see alignment E=5.8e-179 PF08240: ADH_N" amino acids 30 to 109 (80 residues), 47.8 bits, see alignment E=2.3e-16 PF00107: ADH_zinc_N" amino acids 159 to 263 (105 residues), 45.2 bits, see alignment E=1.3e-15 PF13602: ADH_zinc_N_2" amino acids 192 to 332 (141 residues), 69 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 40% identical to ZDH1_STAAR: Zinc-type alcohol dehydrogenase-like protein SAR2277 (SAR2277) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2953)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IP6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PP_2953 Alcohol dehydrogenase, zinc-containing (Pseudomonas putida KT2440)
MKAISFIHKGLPIEDPASLQDIFMPKPSPGPRDLLVEVKAVSVNPVDTKVRAGTFTGEPK
ILGWDAAGVDREVGRQVTLFKPGDQVYYAGSIARPGSYSEYHLVDERIVGHQPRSLGAAQ
AAALPLTAITAWELLFDRLGIAEGGGEGDALLIVGAAGGVGSMLVQLARQLTRLTVIGTA
SRAETSNWVRELGAHHVIDHSAPLQGQLQALGIESVSHVASLTHTDQHFAQLVEVLRPQG
RLGVIDDPQTLDVMPLKRKSLSLHWELMFTRSLYETDDMVRQHELLERVAGLIDQGTLRT
TLGEHFGAINAANMRRAHALVESGKARGKIVLEGF