Protein Info for PP_2945 in Pseudomonas putida KT2440

Annotation: putative sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF02518: HATPase_c" amino acids 356 to 462 (107 residues), 97.3 bits, see alignment E=7.8e-32

Best Hits

KEGG orthology group: K02482, two-component system, NtrC family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_2945)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IQ4 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PP_2945 putative sensor histidine kinase/response regulator (Pseudomonas putida KT2440)
MSDMINRRILLIDDMPTIHEDFRKILAPARSQNSELDEMEGLLFGEQVKNERPVFELDSA
YGGEEGLGLLKRALQASKPYALAFVDMRMPGGWDGAQTIEHLWEEDPLLQVVVCTAYSDY
SWDELLDRLQAHDRLLILKKPFDNIEVQQMASTLLTKWEMTQRASLKMHQLEQRVERRTQ
QLTQASEALQQEIEERKQLESQLVQSEKLASLGQMAAGVAHEINNPIGFVSSNLGTLGGY
FQQLVAMLDAYREAELMLGANETTGRLQRLREQTELEFLMEDIPILIKESKDGIGRVAHI
VKDLKDFSRVDSAQQWQLADLQQGIDSTLNIVASELKHKADLVKRYQPLPPVECLPSQIN
QVIMNLVLNAAQAMGPERGTITLGTAHQGAWVCIEVADTGAGIAPENIKKIFDPFFTTKP
VGQGTGLGLSLSYGIVKKHGGEITVSSQVGVGTTFRVQLPVKQSATL