Protein Info for PP_2929 in Pseudomonas putida KT2440

Annotation: Carboxynorspermidine/carboxyspermidine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01047: carboxynorspermidine decarboxylase" amino acids 2 to 361 (360 residues), 409.1 bits, see alignment E=6.2e-127 PF00278: Orn_DAP_Arg_deC" amino acids 210 to 320 (111 residues), 23.8 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 66% identical to NSPC_HERAR: Carboxynorspermidine/carboxyspermidine decarboxylase (nspC) from Herminiimonas arsenicoxydans

KEGG orthology group: K13747, carboxynorspermidine decarboxylase [EC: 4.1.1.-] (inferred from 100% identity to ppf:Pput_2763)

MetaCyc: 53% identical to carboxynorspermidine decarboxylase (Vibrio vulnificus CMCP6)
RXN-11564 [EC: 4.1.1.96]; 4.1.1.96 [EC: 4.1.1.96]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IS0 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PP_2929 Carboxynorspermidine/carboxyspermidine decarboxylase (Pseudomonas putida KT2440)
MIKTPYYLIDKTKLLSNMEKIAYVREHSGAKALLALKCFATWSVFDLMQQYMDGTTSSSL
FELKLGRQKFAGETHAYSVAWADDEVEEMLENCDKIIFNSIGQLQRFAEQSEGKVRGLRV
NPQVSSSDYLLADPARPFSRLGEWDPAKIEQVIEQISGFMFHNNCENGDFGLFDKMLTHI
EERFGHLLHKVEWVSLGGGIHFTGEDYAVDAFCARLKAFSEKYGVQVYLEPGEAAITNSA
SLEVTVLDTLYNGKHLAVVDSSIEAHLLDLLIYRLNAKMAPNDGEHTYMVCGKSCLAGDI
FGEYQFDRPLAIGDRLSFIDTAGYTMVKKNWFNGLKMPSIVVKQLDGSVEVVREFGFEDY
VSSLS