Protein Info for PP_2926 in Pseudomonas putida KT2440

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 184 (184 residues), 204.6 bits, E=1.6e-64
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 417 (417 residues), 438.4 bits, E=1.2e-135
• PF00984: UDPG_MGDP_dh
  • amino acids 201 to 293 (93 residues), 128 bits, E=1.9e-41
• PF03720: UDPG_MGDP_dh_C
  • amino acids 317 to 421 (105 residues), 98.6 bits, E=3.7e-32

Best Hits

Swiss-Prot: 44% identical to UDG_RHIME: UDP-glucose 6-dehydrogenase (rkpK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to ppu:PP_2926)

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

See Q88IS3 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PP_2926 UDP-glucose 6-dehydrogenase (Pseudomonas putida KT2440)
MKVTVFGTGYVGLTQAVCLAQVGHSVLCMDVDADRVASLSEGHCPIFEPGLAPLLEKNLA
CGRLRFTTDAAAAANYARLQFIAVGTPPQADGSADLKHVFAVVDSILEHADGPKVIVNKS
TVPVGTVHRIKARIAQAVADTSRFQVISNPEFLKEGSAVDDCMRPQRIIIGGAEAAEVEL
LRELYLPFNRNREKFMVMDARSAELTKYAANCMLATKISFINEIANLAEHLGADIEMVRR
GIGSDPRIGYDFIYAGCGFGGSCFPKDLQALRHSAEAEGFETQLLRAVESVNEQQKGRLF
SKIQRHYPGGLRGKVFALWGLSFKPNTNDIREASSRVLLEALWAAGARVQAHDPQAMEEI
RRHYGPRADLQLVPCKDDALRGADALVIVTEWQDYRVLNLDEVPQQLADRVVFDGRNLYE
PEHMASAGLAYYGIGRGKIAPA