Protein Info for PP_2911 in Pseudomonas putida KT2440

Annotation: gamma-aminobutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details TIGR01773: GABA permease" amino acids 6 to 449 (444 residues), 727.1 bits, see alignment E=3.9e-223 PF03845: Spore_permease" amino acids 14 to 256 (243 residues), 26.9 bits, see alignment E=3.4e-10 PF00324: AA_permease" amino acids 16 to 430 (415 residues), 426.1 bits, see alignment E=2.6e-131 PF13520: AA_permease_2" amino acids 17 to 440 (424 residues), 124.6 bits, see alignment E=7.5e-40

Best Hits

Swiss-Prot: 71% identical to GABP_ECOLI: GABA permease (gabP) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 99% identity to ppf:Pput_2780)

MetaCyc: 71% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"gamma-aminobutyrate (GABA) permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IT8 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_2911 gamma-aminobutyrate permease (Pseudomonas putida KT2440)
MQTHKNNLSHGLKSRHVTMLSIAGVIGAGLFVGSGRAIAEAGPATILAYILAGGLVVLVM
RMLAEMAVASPDTGSFSTYADLAIGKWAGYTIGWLYWWFWVLIIPIEANIAATIINSWVP
QLEIWVLSLVITLLLTATNLFSVKNYGEFEFWLALVKVVAIVSFIALGVCAIFGLLPGAG
VSGVSRLWDTGGFMPNGFGAVLSAMLITMFSFLGAEVVTIAAAESDEAGKHISKATNSVI
WRITLFYILSIFIVIALVPWTDPRLATEGSYVTVLDTLGVPNAKAIIDFVVLTSVTSCLN
SSLYTASRMVYSLSRRGDAPACAQITSRSGTPVVAVLLSTGAAFLAVIANYLVPAKVFGF
LMASSGAIALLVYLVIAISQLRLRQRLTAQGKTLGYRMWLFPWLTWGVILFISGVLVLML
FRPDHRLEVVSTMVLAVLVVCSGVLVTRRRARGGAVAGVGQGA