Protein Info for PP_2909 in Pseudomonas putida KT2440

Updated annotation (from data): glutarate hydroxylase
Rationale: Specifically important in carbon source 2-Piperidinone; carbon source 5-Aminovaleric acid. This is part of the pathway from L-lysine and 5-aminovalerate to succinate. For detailed rationale and biochemical evidence, see https://doi.org/10.1101/450254
Original annotation: carbon starvation induced protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GLAH_PSEPK: Glutarate 2-hydroxylase (glaH) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2909)

MetaCyc: 100% identical to glutarate dioxygenase monomer (Pseudomonas putida KT2440)
RXN0-7316 [EC: 1.14.11.64]

Predicted SEED Role

"Carbon starvation induced protein CsiD"

MetaCyc Pathways

glutarate degradation (2/2 steps found)
L-lysine degradation I (5/7 steps found)
superpathway of L-lysine degradation (23/43 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IU0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PP_2909 glutarate hydroxylase (Pseudomonas putida KT2440)
MNAFTQIDELVMPLPLEPQGYTIAPSKQSPRLLELTFARETVEAFVQAVAQWPVQALEYK
SFLRFRVGEILDELCQGTLRPVLLNTILDRATGGMLITPIGLDDVSQAEDMVKFTTACAH
LIGRSNYDAMSGQFYARFVVVNSDNSDSYLRQPHRVMELHNDGTFVNQITDYVLMLKIDE
KNMEGGNSLLLHLDDWEQCEAFFRHPLARREMRWTAPPSKKVAEDVFHSVFDTDAEGRPT
MRYIDQFVQPENYEEGIWLNALSESLEGSGKKVSVPVGVGSFLLINNLFWLHGRDRFTPH
EGLRRELMRQRGYVAFPKPLYQRGQ