Protein Info for PP_2908 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00392: GntR" amino acids 15 to 72 (58 residues), 49 bits, see alignment E=3.9e-17 PF07729: FCD" amino acids 82 to 212 (131 residues), 67.7 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 59% identical to GLAR_ECOLI: HTH-type transcriptional repressor GlaR (glaR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2908)

Predicted SEED Role

"CsiR, transcriptional repressor of CsiD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IU1 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PP_2908 DNA-binding transcriptional repressor (Pseudomonas putida KT2440)
MEALAPRQNSAFSGYERLKKDIIRGVFKPGEKLLMSTLKERYDLGVGPLREALSQLVAEH
LVNAISQKGYRVAPMSLDEMNDIYDARANLEAMIIALAIERGDDAWEASVLAHSHTLAKV
VEVKTREQRLDVWDERHKAFHTAIASGCGSKHLLQARTYLFDQAERYRHLWLTQTVFSEE
ALALKRQEHAALVEVILARDAKTASAMMRSHLMTPVPIIAQIMHAEGIGAR