Protein Info for PP_2906 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF00672: HAMP" amino acids 182 to 233 (52 residues), 39.1 bits, see alignment 1.5e-13 PF00512: HisKA" amino acids 245 to 302 (58 residues), 27 bits, see alignment 7.6e-10 PF02518: HATPase_c" amino acids 350 to 459 (110 residues), 81.8 bits, see alignment E=9.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2906)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IU3 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_2906 Sensor histidine kinase (Pseudomonas putida KT2440)
MPLLNPSKGWSSSTSRLLALYSFLFVAWSSILMGVLYFEVSSYLNKLTRHSMLQRQHLFA
HMSGKQLDDALIASQAFEERSFDAYGLFDSQLNPIGGTVRALPPELRLDGKIHELERCLD
ADDPRMPRDSCDAVAIKVQDGRWLVLVRDNGSLFVVTRIILHALLWGISLTLIPGFAGWY
LLRRRPLKRIRAIQAQAELIVAGDLTHRLPLSARRDELDMLAAIVNAMLDRIERLMHEVK
GVCDNIAHDLRTPLTRLRAQLYRIRQQSDVDSAQAEALDQAIGETDTLMARFRGLLRISE
LEDRQRRAGFIQLDPHELLVELHDFYLPLAEDGGIQLQLHQPAQLPALHGDRELLFEALA
NLVGNAIKFTPEGGRVRITATQDDSGVHMAIEDSGPGIPEAERTAVLKRFYRSDEGHRHA
GFGLGLSIVAAIVDLHGFGLEIGGSELGGARLVLHCPLAGLSK