Protein Info for PP_2902 in Pseudomonas putida KT2440

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 2 to 198 (197 residues), 43 bits, E=7.4e-15
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 3 to 231 (229 residues), 333.2 bits, E=3.4e-104

Best Hits

Swiss-Prot: 100% identical to LPXH_PSEPK: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 100% identity to ppu:PP_2902)

MetaCyc: 46% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (16/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

See Q88IU7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>PP_2902 UDP-2,3-diacylglucosamine hydrolase (Pseudomonas putida KT2440)
MILLISDLHLQEERPDISRAFLDLLDGRARHAKALYILGDFFEAWIGDDAMTPFQQSICQ
AMRRLSDSGTAIYLMHGNRDFLIGQAFCKAAGCTLLNDPSVIELGGEQVLLMHGDTLCTR
DLGYMKMRRLLRNPLSLWILRHLPLSARYKLARKLRSESRTQVRMKSTEIVDVTPEEVPK
VMAAHGVRTLVHGHTHRPAIHKLMVDGQPARRIVLGDWDRRGWALQVDEQGFQLAPFEFS