Protein Info for PP_2885 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 373 (345 residues), 132.5 bits, see alignment E=1.8e-42 amino acids 237 to 404 (168 residues), 47.5 bits, see alignment E=1.3e-16 PF00083: Sugar_tr" amino acids 40 to 209 (170 residues), 28.5 bits, see alignment E=7.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2885)

Predicted SEED Role

"Probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IW4 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PP_2885 putative Transporter (Pseudomonas putida KT2440)
MPLCPGLPMNVAKDPATLLPASTLNLRPLLLANMACTMSMMAFVALIGPIARQLGMATWQ
AGAAVTVAGVVWVLLARPWGRAADRLGRRRILLLGSAGFTLAYWLLCLFVEGALRWMPGA
TLAFIGLMIARGCIGAFYAAIPVGYNALIADHVEPQRRARAMASLGAANAVGLVVGPALA
ALLARHSLSLPFHIMSLLPATAFLVLFFTLKPQALPHSHAPSPVRLNDPRLRRPLLVAFS
AMLSVTVSQIIVGFFALDRLHLGPAEAAQAAGIALTTVGVALMLAQVILRQLEWPPLKMI
RVGATVSALGFACGSLATTAPWLWACYFVAAAGMGFVFPAFSALAANAMQASEQGATAGS
IGAAQGMGAVIGPLAGTLVYALDPRLPFLAVAVLLLLVGLWPMPREQRV