Protein Info for PP_2877 in Pseudomonas putida KT2440

Annotation: putative osmotic pressure-regulated transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 279 to 305 (27 residues), see Phobius details PF13593: SBF_like" amino acids 13 to 321 (309 residues), 360.2 bits, see alignment E=1.1e-111 PF01758: SBF" amino acids 46 to 218 (173 residues), 50.9 bits, see alignment E=1.6e-17

Best Hits

Swiss-Prot: 72% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to ppu:PP_2877)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IX2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PP_2877 putative osmotic pressure-regulated transporter (Pseudomonas putida KT2440)
MDTVMKYLRMLFDNFTLALLGVVLIATVLPCSGDGAVYFGWLTNLAIGLLFFLHGAKLSR
EAIIAGAGHWRLHLLVFSCTFVLFPLLGLAFKPLFVPLVGNELYLGILYLCALPATVQSA
IAFTSLARGNVPAAICSAAASSLLGIFLTPLLVMLLLGAGGDTGSGLDAVLKITLQLLVP
FVAGQVARRWIGAWVKRNARWLKVVDQGSILLVVYTAFSEAVVTGLWHTVSPQHLAGLFV
VCAILLAVVLFGTRLLGKALGFDLEDRITILFAGSKKSLATGVPMAQVLFVGSGIGAMIL
PLMLFHQIQLMVCAVLAQRYASREQAVEASAVS