Protein Info for PP_2860 in Pseudomonas putida KT2440

Annotation: putative Nicotinamide mononucleotide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 138 to 154 (17 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 3 to 181 (179 residues), 90.1 bits, see alignment E=8.8e-30 PF04973: NMN_transporter" amino acids 3 to 181 (179 residues), 187.3 bits, see alignment E=1.3e-59

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to ppu:PP_2860)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IY9 at UniProt or InterPro

Protein Sequence (188 amino acids)

>PP_2860 putative Nicotinamide mononucleotide transporter (Pseudomonas putida KT2440)
MSGLELIAALLGVTAVWLTVKQNAWCWPIGLVMVLIYGWLFYEVKLYSGMLLQVAYAILQ
LYGWWQWKRPDHAEDARQVSRLPRPALLTGLAAGVLLSAALGAAMANWTDAALPWLDATL
TGFSLVAQLWMAQKRLQCWPLWIVVDIVYVGQYLHQQLYFTAGFFAVLTLIAVRGWLEWR
RDPAVVQP