Protein Info for PP_2847 in Pseudomonas putida KT2440

Annotation: Urease accessory protein UreJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details PF04955: HupE_UreJ" amino acids 8 to 177 (170 residues), 106.4 bits, see alignment E=6.3e-35

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to ppf:Pput_2842)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J02 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PP_2847 Urease accessory protein UreJ (Pseudomonas putida KT2440)
MKKTFALFLLMLALPAFAHPGHDSNPLQDGLLHPLTGLDHLLMLLGTGVLAALTRRNLTL
PLATLAAMFGGAVCGHLFGDVLGMETLIAVSLLVAAGAVLLPSRQSLLAMAMPVFALFHG
WAHGVEATPSAFWQFSAGFVVVSGLLLAAGFAVGCLLRRHSGLQKAFGGGLLAGAALVLA
G