Protein Info for PP_2840 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF05940: NnrS" amino acids 13 to 387 (375 residues), 359.6 bits, see alignment E=1.3e-111

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to ppu:PP_2840)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J09 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PP_2840 putative Membrane protein (Pseudomonas putida KT2440)
MLLQPTASRPRQAVWSLSFRPFFLGGSLFALTALLLWAGVLAGAPAPAPPGGMLAWHRHE
MLFGFAAAIIAGFLLTAVQNWSGIPGLSGRALQGLFLLWLLGRVSWFMPLPGSLLVLVEG
SFLPLVALSLARPVLQRRLRNNYPIVVLVLLIAACQWLTLAGWLHQDELWQRRGIFAGLW
LVTAMMTVLGGRVIPFFTRRGLGQLDAAPARPWLDRACLLLSVAVPLAFATGLADTPQAS
LAVLFFALFALHATRLVLWHDRGLWRVPLLWSLHLAYAWLALACLGMALWHSGVALNPSL
VTHALTVGAMTGLILAMMARVSLGHTGRPLQVPTSIAWAFALMQLATLARVILPLFTSLG
VSVSALCWSLALLLFLRHYLPILLRPRADGMPG