Protein Info for PP_2830 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF07690: MFS_1" amino acids 49 to 409 (361 residues), 134.1 bits, see alignment E=3e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2830)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J19 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_2830 Major facilitator family transporter (Pseudomonas putida KT2440)
MPLLRGTPPALFTGKKTMTTLTRAAACAPATTHEQRLNGLLLRKLMPLLIVVYVMSFLDR
TNIALAKASMGIDLGLSAAAYGLGAGLFFLTYALAEVPSNLIMHRVGARFWITRIMITWG
LLSAGMAFVQGETSFYIMRLLLGVAEAGLFPGVMLYLTYWFDREQRARATGYFLLGVCVA
NILSGPLGGALLELDGVLGWHGWQWLFVLEGLPAVALAYVVWKKLPDGPASAPWLTAADA
QDIERRLAAEQAAAPQQSKLGQMFRDRQIWLAIAVYFVHQITIYTVIFFLPGIIGTYAAL
SPFQVGLLTAVPWIAAAIGAATLPRLATSPRRCRTLLFLGLLTMAAGLLLASLTNSFIGL
IGFSLTALMLFVVQSIIFVFPSSRLSGSALAAGLAFVTTCGLFGGFVGPSVMGLIEQTTG
STRNGLWIIAALLVCAALVSTRLRQGQEQP