Protein Info for PP_2820 in Pseudomonas putida KT2440

Annotation: HTH-type transcriptional regulator nfxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 138 to 154 (17 residues), see Phobius details

Best Hits

Swiss-Prot: 68% identical to NFXB_PSEAE: HTH-type transcriptional regulator nfxB (nfxB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2820)

Predicted SEED Role

"Transcriptional regulator NfxB" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J29 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_2820 HTH-type transcriptional regulator nfxB (Pseudomonas putida KT2440)
MHLPTDERLLKALADAIVVHPRATLKELAEAAGVSKATLHRFCGTRDNLVNMLESYGDQV
LTQVIGNADLHGSDPTAALHRLIVEHLKHREMMIFLLFQYRPDSFDDSETNRPWRAYADA
LDAFFLRGQQAGAFRIDISAAIFTEMFLSMVYGIVDAERRGRAASATSVQTLELLFLDGA
AAPAR