Protein Info for PP_2797 in Pseudomonas putida KT2440

Annotation: acetate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details amino acids 358 to 386 (29 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details amino acids 464 to 487 (24 residues), see Phobius details amino acids 499 to 517 (19 residues), see Phobius details PF00474: SSF" amino acids 62 to 471 (410 residues), 356.5 bits, see alignment E=9.2e-111 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 62 to 471 (410 residues), 198.6 bits, see alignment E=9.2e-63

Best Hits

Swiss-Prot: 59% identical to ACTP_ERWT9: Cation/acetate symporter ActP (actP) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to ppu:PP_2797)

MetaCyc: 59% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J52 at UniProt or InterPro

Protein Sequence (552 amino acids)

>PP_2797 acetate permease (Pseudomonas putida KT2440)
MKKLVPLALLLHSGLLLASPSLDAGQRQPLNLHAIGMFMVFVLFTLCITWWAARRTRSTT
DFYSAGGGIQGWQNGLALAGDYMSASTLLGITALIYTSGMDGYIYLIAFFAGWPVLLLLM
TERLRNLGRFTFADITSYRLDQGKVRTMAAIGSLTVVCFYLVAQMVGAGQLIRLLFGLDY
HIAVVIVGALMMLYVTFGGMVATTWVQIIKAFLLLVGGSLVLFLAMREFDFSYDALVSKA
MDTHALGERLLAPGSLLADPLTALSLSLGLVFGTAGLPHILMRFFTVSDAREARKSVLYA
TGFIGYFFNVIFLLGLASIVIVSQQPKFFEGGEVGGKLLGGGNMVVMHLAQAVGGNLLLG
FLSAVTFATILAVVSGLALAGASAIAHDLYARVIMKGAASEAQELRVTKLATLSLGLVAI
ALGILFENINVAFMVALAFGIAASANFPVLFLSMFWSGLTTRGALAAGYVGLLSAMGFVV
FSKLVWVDVLHFAEPLFPYTQPALFSMPLAFLVAYAVSRMDRTARAKAERAAFADQFVRG
QTGLGASGAVDH