Protein Info for PP_2794 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 16 to 200 (185 residues), 176.9 bits, see alignment E=6.7e-56 PF01370: Epimerase" amino acids 16 to 173 (158 residues), 30.2 bits, see alignment E=6e-11 PF08659: KR" amino acids 17 to 166 (150 residues), 52.8 bits, see alignment E=9.5e-18 PF13561: adh_short_C2" amino acids 20 to 249 (230 residues), 182.4 bits, see alignment E=2.2e-57

Best Hits

Swiss-Prot: 37% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2794)

MetaCyc: 100% identical to 4-oxopentanoyl-CoA 4-dehydrogenase (Pseudomonas putida KT2440)
1.1.1.M44 [EC: 1.1.1.M44]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J55 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_2794 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MQPNLARLFALDGRRALVTGASSGLGRHFAMTLAAAGAEVVVTARRQAPLQALVEAIEVA
GGRAQAFALDVTSREDICRVLDAAGPLDVLVNNAGVSDSQPLLACDDQTWDHVLDTNLKG
AWAVAQESARRMVVAGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARH
GIRVNALAPGYVMTDLNEAFLASEAGDKLRSRIPSRRFSVPSDLDGALLLLASDAGRAMS
GAEIVVDGGHLCSSL