Protein Info for PP_2787 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 414 to 439 (26 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details amino acids 696 to 714 (19 residues), see Phobius details amino acids 721 to 741 (21 residues), see Phobius details amino acids 747 to 767 (21 residues), see Phobius details amino acids 795 to 814 (20 residues), see Phobius details amino acids 820 to 847 (28 residues), see Phobius details PF03176: MMPL" amino acids 192 to 468 (277 residues), 58.1 bits, see alignment E=7.7e-20 amino acids 667 to 835 (169 residues), 28.9 bits, see alignment E=5.7e-11 PF12349: Sterol-sensing" amino acids 316 to 439 (124 residues), 28.5 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to ppu:PP_2787)

Predicted SEED Role

"Predicted exporter of the RND superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J62 at UniProt or InterPro

Protein Sequence (869 amino acids)

>PP_2787 putative Transporter (Pseudomonas putida KT2440)
MERYLNFVERYARAIVFVLVAITAYFTYTLGALMSDTNPYLLKDTHPARKTIIDLQREFT
GTYDSVMVALNNPVSVFNTTSLNAQFELSQAIRQLMLANDEDRVELQRIVGLHSDDPDAQ
GLLVQILAEGFSQNDYAAAKALRDHGIARHWDSHDLQFLSFLAERINPIQEMASMADLEN
ISLSADGELWIHKTLHALDMDPIKVEAQIMGNEQMVGGVVSADKKVAMVVAELGTKQDDA
QAQLRAYHQVREIIAKYQAAHPEFTDEVFIAGMPIFIAAQQEIIDHDLAMLFPIVFLLVT
SLLVFFFRKPLGVVLPLFNILFCTIWTLGLMALLRVPMDLLTSVLPVFLFTICCADAIHV
MAEYYEQLNSGKSFREANRETQRLMVTPVVLTTVTTIATFLISTTNNIVSIRNFGVFMSI
GLTAALIISLLLIPAWISIWGKDAVPRKVQLKESLISHYLVVFCAWLIRWRKPVLLVTLP
LLAMMTVFTFKVDIEDSGIAYFKKDSPVRMSDEFINRAGVAGTSPGWIAFDTKTPRGALT
TETVQFLDRLDQFIKAQPNVSYTYSVATYIKRMNLVLNDMNPAFLRVPQAVEQVTVVDDD
GKPETFDVDGNSLIEQHIMMFENGGGTDLQNVLNADYSKAVTLFTMTSSVAGDYQAMLDK
LDAWLAINKPANLQVTHAGTPYIWTGVLQEITQGQVLSFSLALLAVTLMMMFWLKSVRLG
ILGMLTLLTTSVTVYGSMYLLDIELNIGTTLVTFLVVGVVDYAVHLLSRIKMLVQKGIEI
DEAILAAMQGVGRSTVVNVVIFSMGFVALLFSAYKPVIDLGVLVILALSSSGFMTILLVT
LISPWFFASIVPQPAVQEGEQPGGGAVPG