Protein Info for PP_2772 in Pseudomonas putida KT2440

Annotation: putative Monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02771: Acyl-CoA_dh_N" amino acids 14 to 114 (101 residues), 46 bits, see alignment E=9.7e-16 PF08028: Acyl-CoA_dh_2" amino acids 235 to 370 (136 residues), 63.2 bits, see alignment E=4.8e-21 PF00441: Acyl-CoA_dh_1" amino acids 241 to 367 (127 residues), 41 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 80% identical to SFNC_PSEPU: Probable FMNH2-dependent monooxygenase SfnC (sfnC) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2772)

MetaCyc: 42% identical to DszC (Rhodococcus sp. IGTS8)
RXN-621 [EC: 1.14.14.21]; 1.14.14.21 [EC: 1.14.14.21]

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J77 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PP_2772 putative Monooxygenase (Pseudomonas putida KT2440)
MTTPLRPAVLTPLQTARRLATEFAETAVERDEAGGTPKAQRDAIRQSGLLALSIPTQFGG
LGASWSETLEVVREFARVDSSIAHVFGFQHLMLATVRLFSRRDQWQPWFEQTARKNWFWG
NALNPLDSRTVLTRFDGWYEFSGKKSFCSGASDSEMLIASAVDESAGGKLLIAAIPSGRT
GITLHDDWNNMGQRQTDSGSATFERVRVEENEMLLDPGPLSTPFASLRPLIAQLHFANVF
LGITEGALEEARHYTLKEGRPWFRSTARHVSEDPYILRHYGEFWVGLEGVRLLVERAATQ
LDAAWHKEQALGAEERAQLALAIATAKVAAARTGLDICNRLFEVTGARATHASLRLDRYW
RNLRTQSLHDPLDYKLHELGEWALSHTRPTPSFYS