Protein Info for PP_2769 in Pseudomonas putida KT2440

Annotation: putative Branched-chain amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 27 to 43 (17 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 159 to 175 (17 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 239 to 282 (44 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 303 (253 residues), 90.6 bits, see alignment E=5e-30

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to ppu:PP_2769)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J80 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PP_2769 putative Branched-chain amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MLYREAGQFSVRYADDRRFFRLRQDRLGLAALVLFAFIGVPLLGNDYWFSAILIPFLLLS
LAGLGLNLLTGYAGQLSLGSAAFMAVGAFAAYNFELRVAWLPLLASLLLGGLVAALVAVV
FGLPSLRIKGFYLLVSTLAAQFFVPWALTRFSWFSNDSASGVISALFWLGANLVRSELGR
NWMAVRDMDTAAAVIGIPLLKTKLLAFAISGFYLGVAGSLWAFTYLGTVEPHGFDLNRSF
QILFIIIIGGLGSILGNFLGAAFIVLFPVLLSNLAGLLPTGLIDAGQIENLQKIAFGTLI
IIFLIKEPEGLARLWQRFRERARRWPLRY