Protein Info for PP_2765 in Pseudomonas putida KT2440

Annotation: putative Sulfonate monooxygenase MsuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR04021: dimethyl sulfone monooxygenase SfnG" amino acids 5 to 353 (349 residues), 626.9 bits, see alignment E=5.6e-193 PF00296: Bac_luciferase" amino acids 6 to 325 (320 residues), 218.3 bits, see alignment E=8.3e-69

Best Hits

Swiss-Prot: 95% identical to SFNG_PSEPU: FMNH(2)-dependent dimethylsulfone monooxygenase (sfnG) from Pseudomonas putida

KEGG orthology group: K04091, alkanesulfonate monooxygenase [EC: 1.14.14.5] (inferred from 99% identity to ppf:Pput_2989)

MetaCyc: 95% identical to dimethylsulfone monooxygenase (Pseudomonas putida DS1)
RXN-14709 [EC: 1.14.14.35]

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.5

Use Curated BLAST to search for 1.14.14.35 or 1.14.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J84 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PP_2765 putative Sulfonate monooxygenase MsuD (Pseudomonas putida KT2440)
MSQPIKFAYWVPNVSGGLVVSKIEQRTSWDIDYNRKLAQIAERSGFEYALSQIRFTAGYG
ADNQHESVTISHALLAATEKLKVIAAILPGPWTPVLAAKQLASIDQFTAGRIAINVVSGW
FKGEFRAIGEPWLDHDERYRRSEEFIRALKGIWTQDNFSFHGDFYRFNDYTLKPKPLQQP
HPEIFQGGSSRAARDMASKVSDWYFTNGNSVEGIKTQVDDIRTKAAANGHSVKVGVNAFI
IARDTEEEARAVLAEIIAKADPEAVNGFGSEVKNAGAASPEGEGNWAKSTFEDLVQYNDG
FKTNLIGTPRQIAERIVALKAVGVDLILSGFLHFQEEVEYFGKHVLPLVRELEQEQHASL
AVA