Protein Info for PP_2760 in Pseudomonas putida KT2440

Annotation: putative ribose transport permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 317 (271 residues), 72.1 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to ppu:PP_2760)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J89 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PP_2760 putative ribose transport permease protein (Pseudomonas putida KT2440)
MPMPLLSDAFHPRFAQWLLRRGALLAFAAILLAFALSAPNFLTLSNLVNVLAQSAILGSL
AFGLTTVIIGGGSNVVSGGLDLSLAANLGLSAAVYASLNNAGFGDVVSIAATLGTGLAIG
TLNALVVVGFRLPPLLATLATMNLVAGLELVLTENTVLPSTSPLLEGLAFGSWVGVPALA
WVLLAVGGVLIVLTQYTPFGLRLYAIGEYPEAANAAGLSVRGYVFASYLISGLCGSLAAF
CSAAWFSGSTTGSGEMLLSVVAIAFLGVIFSQRLQPSIGGTLLATLLVGVLINGFQLLNI
SSFWVDGVQGVLILLVVALSGLRNKEA