Protein Info for PP_2744 in Pseudomonas putida KT2440

Annotation: Ribose-phosphate pyrophosphokinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF13793: Pribosyltran_N" amino acids 8 to 126 (119 residues), 87.1 bits, see alignment E=1.2e-28 TIGR01251: ribose-phosphate diphosphokinase" amino acids 8 to 313 (306 residues), 198.3 bits, see alignment E=7.3e-63 PF00156: Pribosyltran" amino acids 147 to 259 (113 residues), 43 bits, see alignment E=4.7e-15 PF14572: Pribosyl_synth" amino acids 217 to 310 (94 residues), 44.4 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 100% identity to ppu:PP_2744)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JA5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PP_2744 Ribose-phosphate pyrophosphokinase family protein (Pseudomonas putida KT2440)
MNDTPPLLFALQGSQDYGNAVAQRLGRKLSAHEERDYEDGEHKCWPGESVDGRSVIVFHS
LYGDAHHSAHDKLCRLLFFCGALKDAAARQVTAVTPYLCYGRKDRKVEFQDAIITRHVAR
LMESCGVDRIVALDVHNPSAFDNAYRIPSWNLQCTQLFAQRLAPLLGEQAVTVVSPDIGG
VKRAEQFRQALAHLLARPVSVAMMEKHRQQAGLSGEHLVGNVAGSTVIVFDDLISTGQTL
LRAAQACRQAGASRMLAAATHGLFTTGGELFDSGAFERVLVADSIAPFRLPVRCLEQLDI
VDTSALVAELLANRSGPGA