Protein Info for PP_2737 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 106 to 121 (16 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF00106: adh_short" amino acids 6 to 187 (182 residues), 125.9 bits, see alignment E=1.4e-40 PF13561: adh_short_C2" amino acids 8 to 190 (183 residues), 108.3 bits, see alignment E=4.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2737)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JB2 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PP_2737 Oxidoreductase, short-chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MSRCWLTGASSGIGAALAQVLLEQGHQVALGGRNADRLAPLAERFPGQALLAIGDLDNPE
QVAGIAAHIEQAWGGLDMAILNAGTCEYLEPGHFDPALVERVMRTNLLGVSYCLAAALPL
LRAGKRPHLVVMGSSVTWLALPRAGAYGASKAAVRYLVESQRIDLAREGIAVTLVSPGFV
DTPLTRRNDFPMPQLWSAQRAARHIARRLPGRPLEINFPGLFTLVLRLLGALPARLRLAL
GQRLARHEQE