Protein Info for PP_2714 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 17 to 160 (144 residues), 36.7 bits, see alignment E=1.1e-12 PF26769: HAMP_PhoQ" amino acids 187 to 231 (45 residues), 31.1 bits, see alignment 4.6e-11 PF00512: HisKA" amino acids 240 to 300 (61 residues), 48.9 bits, see alignment E=1.4e-16 PF02518: HATPase_c" amino acids 350 to 453 (104 residues), 88.4 bits, see alignment E=1.1e-28 PF13581: HATPase_c_2" amino acids 351 to 435 (85 residues), 28.1 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2714)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JD5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PP_2714 Sensor histidine kinase (Pseudomonas putida KT2440)
MTSLRQRTLWRVMLLLLLGTGLLALYNYHDSSHEINEVYDAHLAQNARLLQGVMSMPVQE
GSREALYQAFNDALGKAGRHQVGHPYESKLAFQVWGEGMALLVHTPSAPPIDPPPTAPGF
YDFSSGGEQWRGFVLPVPEKHWLIWVGERDDVRYDLIDRIVRHTLFPFLLGSLALALLVW
AAIGWGLRPLQNMANVIRRRHADSLEPLQLVPLPTELEPMQAAINRLLAQIDDLLRREHR
FIADAAHEMRTPLAVLRLHAQNALAASNDAERQKALGFLVGGVDRLTRVVNQLLTLARVE
PRLGQRASTRIDLAEVVTETLAELTPWILDRGLEPSLDIDEGDHHLQIDAGALGIALQNL
VSNAVEHSPPGGRIAVSLRRLDSSVELVVEDEGTGIDEESLSRVFERFYSRNSPNGAGLG
LSIVATIIDRMGGQVRLENRAGGGLAATLSFPLS