Protein Info for PP_2683 in Pseudomonas putida KT2440

Annotation: putative sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 TIGR00229: PAS domain S-box protein" amino acids 40 to 164 (125 residues), 48.7 bits, see alignment E=3.9e-17 PF00512: HisKA" amino acids 196 to 259 (64 residues), 40.8 bits, see alignment E=3.8e-14 PF02518: HATPase_c" amino acids 305 to 414 (110 residues), 76.3 bits, see alignment E=5.2e-25 PF00072: Response_reg" amino acids 440 to 549 (110 residues), 43.2 bits, see alignment E=7.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2683)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JG6 at UniProt or InterPro

Protein Sequence (556 amino acids)

>PP_2683 putative sensory box histidine kinase/response regulator (Pseudomonas putida KT2440)
MARPSDEQQRALAGLLGLGDHSARKSHYPELSARLDELEAERNRYKWLFENAVHGIFQAS
LQDGMRAANPALARMLGYDDPQAVLFSLTDLAANLFDGGAEELQAITAVLAREHSLHGYE
TRLRRKDGSHLDVLMNLLLKPGHEGLVEGFVADITERKLAQQRLQQLNDELEQRVAARTD
ELLEARDAAEAANRSKDKYLAAASHDLLQPLNAARLLISTLRERPLPEAEHVLVERTHQA
LEGAEDLLTDLLDISRLDQAAVKPDVAVYRLDELFAPLVSEFSPVAEAAGLKLHARIADY
AISTDLRLLTRILRNFLSNACRYTEEGRILLGARRRGGHLRLEVWDTGRGIAQDRLQDIF
LEFNQLDVGRAADRKGVGLGLAIVERIAKILGYRIEVRSWLGRGSVFSIEVPLGKEVPLA
VHQAVPLPSVGDPLPGRRLLVLDNEVSILESMGALLGQWGCEVVTATDREGALLALQGRA
PELILADYHLDHGVVGCEVVRYLREHFATAIPAVIITADRSDQCRRGLQKLGAPLLNKPV
KPGKLRAVLSQLLLVH