Protein Info for PP_2682 in Pseudomonas putida KT2440

Annotation: Fe-containing alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 14 to 379 (366 residues), 388.5 bits, E=2.8e-120
• PF13685: Fe-ADH_2
  • amino acids 19 to 112 (94 residues), 39 bits, E=8.4e-14

Best Hits

Swiss-Prot: 38% identical to DHAT_CITFR: 1,3-propanediol dehydrogenase (dhaT) from Citrobacter freundii

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2682)

MetaCyc: 35% identical to NAD-dependent methanol dehydrogenase monomer (Bacillus methanolicus)
Methanol dehydrogenase. [EC: 1.1.1.244]

Predicted SEED Role

No annotation

MetaCyc Pathways

• methanol oxidation to formaldehyde II (1/1 steps found)
• methanol oxidation to carbon dioxide (3/6 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.244

Sequence Analysis Tools

See Q88JG7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PP_2682 Fe-containing alcohol dehydrogenase (Pseudomonas putida KT2440)
MSQSFSPLRKFVSPEIIFGAGCRHNVANYAKTFGARKVLVVSDPGVIAAGWVADVEASLQ
AQGIDYCLYTAVSPNPRVEEVMLGAEIYRQNHCDVIVAVGGGSPMDCGKAIGIVVAHGRS
ILEFEGVDMIRVPSPPLILIPTTAGTSADVSQFVIISNQQERMKFSIVSKAVVPDVSLID
PQTTLSMDPFLSACTGIDALVHAIEAFVSTGHGPLTDPHALEAMRLINGNLVEMIANPTD
IALREKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSA
PERFKVIAEVFGIDCRGLNHRQICGRLVEHLIALKRAIGFHETLGLHGVRTSDIPFLSQH
AMDDPCILTNPRASSQRDVEVVYGEAL