Protein Info for PP_2674 in Pseudomonas putida KT2440

Annotation: quinoprotein ethanol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 42 to 594 (553 residues), 790.1 bits, see alignment E=4.8e-242 PF13570: PQQ_3" amino acids 89 to 129 (41 residues), 19.4 bits, see alignment 1.7e-07 amino acids 130 to 178 (49 residues), 22.3 bits, see alignment 2.1e-08 amino acids 518 to 558 (41 residues), 24.9 bits, see alignment 3.2e-09 PF13360: PQQ_2" amino acids 106 to 249 (144 residues), 55.6 bits, see alignment E=9.7e-19 amino acids 508 to 576 (69 residues), 40.1 bits, see alignment E=5.2e-14 PF01011: PQQ" amino acids 111 to 137 (27 residues), 25.5 bits, see alignment (E = 1.2e-09) amino acids 160 to 186 (27 residues), 22.6 bits, see alignment (E = 9.9e-09) amino acids 540 to 576 (37 residues), 41.1 bits, see alignment 1.4e-14

Best Hits

Swiss-Prot: 90% identical to QEDH_PSEPU: Quinoprotein alcohol dehydrogenase (cytochrome c) (qedA) from Pseudomonas putida

KEGG orthology group: K00114, alcohol dehydrogenase (cytochrome c) [EC: 1.1.2.8] (inferred from 100% identity to ppf:Pput_3089)

MetaCyc: 85% identical to alcohol dehydrogenase (cytochrome c550) monomer (Pseudomonas aeruginosa)
RXN-11333 [EC: 1.1.2.8]

Predicted SEED Role

"Quino(hemo)protein alcohol dehydrogenase, PQQ-dependent (EC 1.1.99.8)" (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.8

Use Curated BLAST to search for 1.1.2.8 or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JH5 at UniProt or InterPro

Protein Sequence (631 amino acids)

>PP_2674 quinoprotein ethanol dehydrogenase (Pseudomonas putida KT2440)
MTIRSLPALSPLALSVRVLLMAGSLALGNVATAASTPAAPAGKNVTWEDIANDHLTTQDV
LQYGMGTNAQRWSPLAQVNDKNVFKLTPAWSYSFGDEKQRGQESQAIVSDGVVYVTGSYS
RVFALDAKTGKRLWTYNHRLPDNIRPCCDVVNRGAAIYGDKIYFGTLDARVIALDKRTGK
VVWNKKFGDHSAGYTMTGAPVLIKDKTSGKVLLIHGSSGDEFGVVGQLFARDPDTGEEVW
MRPFVEGHMGRLNGKDSTPTGDVKAPSWPDDPTTETGKVEAWSHGGGAPWQSASFDPETN
TIIVGAGNPGPWNTWARTSKDGNPHDFDSLYTSGQVGVDPSTGEVKWFYQHTPNDAWDFS
GNNELVLFDYKDKNGNVVKATAHADRNGFFYVVDRNNGKLQNAFPFVDNITWASHIDLKT
GRPVENPGQRPAKPLPGETKGKPVEVSPPFLGGKNWNPMAYSQDTGLFYIPGNQWKEEYW
TEEVNYKKGSAYLGMGFRIKRMYDDHVGTLRAMDPTTGKLVWEHKEHLPLWAGVLATKGN
LVFTGTGDGFFKAFDAKTGKELWKFQTGSGIVSPPITWEQDGEQYIGVTVGYGGAVPLWG
GDMAELTKPVAQGGSFWVFKIPSWDNKTAQR