Protein Info for PP_2671 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details amino acids 32 to 36 (5 residues), see Phobius details transmembrane" amino acids 30 to 31 (2 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF00672: HAMP" amino acids 158 to 210 (53 residues), 29.3 bits, see alignment 1.4e-10 PF07730: HisKA_3" amino acids 229 to 294 (66 residues), 54.1 bits, see alignment E=2.8e-18 PF02518: HATPase_c" amino acids 336 to 422 (87 residues), 42 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K07675, two-component system, NarL family, sensor histidine kinase UhpB [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_2671)

Predicted SEED Role

"sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JH8 at UniProt or InterPro

Protein Sequence (424 amino acids)

>PP_2671 Sensor histidine kinase (Pseudomonas putida KT2440)
MRLVNLSALWRVNLWVTLCFALVTLACAGVLLHQAVADVERELQSAEAVVAYLGDTAERD
PANLQPGLTKSLRHVRVHWLAAGEVPRLPQEAGIDAWLGRQLFGERYHSSRLLDLSDGRR
VLIAVDARDEIDEVWDSLQQLLGVCGLALLLSLWTIRWAVRRAMGLLDELLGALHQVSGG
QLTARLREAGLPEARQLAKHFNRMAATLEQAQADNAQLTQALLAVQEQERTQLAQTLHDD
LGQYLAGMRAQLCLLRMVAEQPEMVTQTVQALELNCERLQQGFRALVHNLYPVALHYMPL
AEAFGLLVSQWQASQGIECRLRVGEHLPALPGPSRTHLYRLLQEALTNVARHAGASQVRV
RLQRSPKGLRLFIRDNGCGAHQPQRPGVGLHSMAERARSLGGELRIFSRPGGGWALALNI
PQEV